PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E02754.1.p
Common NameEUGRSUZ_E02754
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 191aa    MW: 21601.7 Da    PI: 5.8106
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E02754.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.48e-2993144253
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkY 53 
                       prlrWtp+LH +Fv+ave+LGG+e+AtPk++l+ m+vkgL+++hvkSHLQ +
  Eucgr.E02754.1.p  93 PRLRWTPQLHYSFVRAVERLGGQERATPKSVLQQMNVKGLSINHVKSHLQIH 144
                       8*************************************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-2689146IPR009057Homeodomain-like
SuperFamilySSF466891.11E-1391145IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-2093143IPR006447Myb domain, plants
PfamPF002492.4E-894142IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MRSLESIEDH QEKSEEKGEK SSPAVSSQKL SSFDLNEEAT FDEHDSPAED DDLISDEDDN  60
SSIREAEDKP GNRNAESAET MKAVRQYVRS KMPRLRWTPQ LHYSFVRAVE RLGGQERATP  120
KSVLQQMNVK GLSINHVKSH LQIHQMTGPD HHFRIENGRI VLARNHCGDS NYSDSDFSRY  180
LYSKAIITAA *
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E02754.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010057109.11e-113PREDICTED: uncharacterized protein LOC104445014
TrEMBLA0A059C6L81e-141A0A059C6L8_EUCGR; Uncharacterized protein
STRINGGLYMA08G12320.21e-39(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.16e-30G2-like family protein